Structure of PDB 5xxb Chain g Binding Site BS02

Receptor Information
>5xxb Chain g (length=121) Species: 5811 (Toxoplasma gondii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KIRAYELRGKSQKELVKQLEDLKKELAQLRVAKVTGSAASKLSKVTEVRK
GIARVLTVYTQKQREEARAAFKGKKFIPNDLRAKKTRAIRRRLTASQTRK
MTVRKMKRTQNVPKRKFALIA
Ligand information
>5xxb Chain 4 (length=157) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaauuuucagcaauggaugucuuggcucgcgcaacgaugaaggacgcagc
gaacugcgaaacgcaaugugaauugcagaauucagugaaucaucagauuu
cugaacgcaaauggcaccuugggguauucuccuugguacgucuguuucag
ugucuuu
.........................................<<<<<<.<<
.....>>>.....(.<<<......>>..............>>>..)...>
>>....<<.....>><<<..<<<<....>>>>..>>>.............
.......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5xxb Cryo-EM structures of the 80S ribosomes from human parasites Trichomonas vaginalis and Toxoplasma gondii
Resolution3.17 Å
Binding residue
(original residue number in PDB)		R5 Y7 R10 K35 S45 T48 R51 A55 R56 L58 T59 T62 R66 K86 T88 R89 R92
Binding residue
(residue number reindexed from 1)		R3 Y5 R8 K33 S43 T46 R49 A53 R54 L56 T57 T60 R64 K84 T86 R87 R90
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Tue Apr 29 22:39:20 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '5xxb', asym_id = 'g', bs = 'BS02', title = 'Cryo-EM structures of the 80S ribosomes from hum...sites Trichomonas vaginalis and Toxoplasma gondii'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='5xxb', asym_id='g', bs='BS02', title='Cryo-EM structures of the 80S ribosomes from hum...sites Trichomonas vaginalis and Toxoplasma gondii')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0000463,0003735,0005840,0006412,0022625', uniprot = '', pdbid = '5xxb', asym_id = 'g'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0000463,0003735,0005840,0006412,0022625', uniprot='', pdbid='5xxb', asym_id='g')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>