Structure of PDB 5we4 Chain g Binding Site BS02

Receptor Information
>5we4 Chain g (length=151) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PRRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAESIVYSALETLA
QRSGKSELEAFEVALENVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAM
RWIVEAARKRGDKSMALRLANELSDAAENKGTAVKKREDVHRMAEANKAF
A
Ligand information
>5we4 Chain w (length=77) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgcgggguggagcagccugguagcucgucgggcucauaacccgaagaucg
ucgguucaaauccggcccccgcaacca
.<<<<<<..<<<<.........>>>>..<<<<.......>>>>......<
<<<<.......>>>>>>>>>>>.....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5we4 Cryo-EM shows stages of initial codon selection on the ribosome by aa-tRNA in ternary complex with GTP and the GTPase-deficient EF-TuH84A.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		S76 R78 R142 M143
Binding residue
(residue number reindexed from 1)		S76 R78 R142 M143
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0015935 small ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5we4, PDBe:5we4, PDBj:5we4
PDBsum5we4
PubMed29733411
UniProtP02359|RS7_ECOLI Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]