Structure of PDB 8scb Chain ff Binding Site BS02

Receptor Information

>8scb Chain ff (length=63) Species: 9986 (Oryctolagus cuniculus)

KSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSVFMASHFDR
HYCGKCCLTYCFN

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 8scb Chain ff Residue 201

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8scb Structure and consequences of eRF1 glued to the ribosomal decoding center
• Resolution: 2.5 Å
• Binding residue (original residue number in PDB): C116 S118 C139
• Binding residue (residue number reindexed from 1): C39 S41 C56
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0031386 protein tag activity
• GO:0031625 ubiquitin protein ligase binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006412 translation
• GO:0016567 protein ubiquitination
• GO:0019941 modification-dependent protein catabolic process

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022626 cytosolic ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8scb, PDBe:8scb, PDBj:8scb
• PDBsum: 8scb
• PubMed: 38172604
• UniProt: G1SK22|RS27A_RABIT Ubiquitin-ribosomal protein eS31 fusion protein (Gene Name=RPS27A)