Structure of PDB 8ipx Chain f Binding Site BS02

Receptor Information
>8ipx Chain f (length=258) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VERPFYDLWASDNPLDRPLVGQDEFFLEQTKKKGVKRPARLHTKPSQAPA
VEVAPAGASYNPSFEDHQTLLSAAHEVELQRQKEAEKLERQLALPATEQA
ATQESTFQELCEGLEKKTEQQRRREKAVHRLRVQQAALRAARLRHQELFR
LRGIKAQVALRLAELARRQRRRQARREAEADKPRRLGRLKYQAPDIDVQL
SSELTDSLRTLKPEGNILRDRFKSFQRRNMIEPRERAKFKRKYKVKLVEK
RAFREIQL
Ligand information
>8ipx Chain 8 (length=156) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgacucuuagcgguggaucacucggcucgugcgucgaugaagaacgcagc
uagcugcgagaauuaaugugaauugcaggacacauugaucaucgacacuu
cgaacgcacuugcggccccggguuccucccggggcuacgccugucugagc
gucgcu
.........................................<<<<<<.<<
.....>>>.....(.<<<......>>.............>>>..)...>>
>....<<....>><<<<<<<<<.....>>>>>>>>>..............
......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ipx Visualizing the nucleoplasmic maturation of human pre-60S ribosomal particles.
Resolution4.3 Å
Binding residue
(original residue number in PDB)		V222 R471
Binding residue
(residue number reindexed from 1)		V35 R251
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0002039 p53 binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0042802 identical protein binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0001932 regulation of protein phosphorylation
GO:0006281 DNA repair
GO:0006364 rRNA processing
GO:0006974 DNA damage response
GO:0007095 mitotic G2 DNA damage checkpoint signaling
GO:0031333 negative regulation of protein-containing complex assembly
GO:0032435 negative regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0039535 regulation of RIG-I signaling pathway
GO:0042254 ribosome biogenesis
GO:0042981 regulation of apoptotic process
GO:0050821 protein stabilization
GO:0051726 regulation of cell cycle
GO:0051898 negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0071456 cellular response to hypoxia
GO:1901796 regulation of signal transduction by p53 class mediator
GO:1901797 negative regulation of signal transduction by p53 class mediator
GO:1901837 negative regulation of transcription of nucleolar large rRNA by RNA polymerase I
GO:1902570 protein localization to nucleolus
GO:1903006 positive regulation of protein K63-linked deubiquitination
GO:1903715 regulation of aerobic respiration
GO:1990173 protein localization to nucleoplasm
Cellular Component
GO:0001650 fibrillar center
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005829 cytosol
GO:0033553 rDNA heterochromatin
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ipx, PDBe:8ipx, PDBj:8ipx
PDBsum8ipx
PubMed37491604
UniProtQ9NZM5|NOP53_HUMAN Ribosome biogenesis protein NOP53 (Gene Name=NOP53)

[Back to BioLiP]