Structure of PDB 8euj Chain f Binding Site BS02

Receptor Information
>8euj Chain f (length=96) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV
MALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Ligand information
>8euj Chain J (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagatactaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagctggattccagctgaacatgccttttgatgga
gcagtttccaaatacacttttggtagtatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8euj Reorientation of INO80 on hexasomes reveals basis for mechanistic versatility.
Resolution3.36 Å
Binding residue
(original residue number in PDB)		R40 Y41 R42 T45 R72 R83 F84 Q85 R116 V117 T118
Binding residue
(residue number reindexed from 1)		R1 Y2 R3 T6 R33 R44 F45 Q46 R77 V78 T79
External links