Structure of PDB 8cvm Chain f Binding Site BS02

Receptor Information

>8cvm Chain f (length=203) Species: 1747 (Cutibacterium acnes) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AHEMPRLKKQYREQIRAAMQEEFGYRNPMLIPGLEKIVVNMGVGDAAHDS
KVMDGAIRDITAITGQKPQVTKARKSIAQFKLREGQPIGCHVTLRGDRMW
EFADRLLTLALPRIRDFRGLNSNQFDGKGNYTFGLSEQVMFLEIDQDKID
RIRGMDITFVTTAQTNEEGKALLKHLGFPFKAKDDPKKAKTKRGPAYYAK
KKK

Ligand information

>8cvm Chain b (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

uuuccgguggccauaguggaagggaaacacccggucccauuccgaacccg
gucguuaagccuuccaacgcugaugguacugcacgagggaucguguggga
gaguaagacgcugccggaau

.<<<<<<<<<<....<<<<<<<<.....<<<<<...............>>
>..>>....>>>>>>.>>.<<.......<<<<<<<<....>>>>>>>>..
.....>>..>>>>>>>>>>.

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8cvm Sarecycline inhibits protein translation in Cutibacterium acnes 70S ribosome using a two-site mechanism.
Resolution	2.66 Å
Binding residue (original residue number in PDB)	N33 P34 M35 Q72 K73 Q75 V98 T99 R101
Binding residue (residue number reindexed from 1)	N27 P28 M29 Q66 K67 Q69 V92 T93 R95

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8cvm, PDBe:8cvm, PDBj:8cvm
PDBsum	8cvm
PubMed	36864821
UniProt	Q6A6N8\|RL5_CUTAK Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]