Structure of PDB 8a3y Chain f Binding Site BS02

Receptor Information
>8a3y Chain f (length=78) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTE
HAKRKTVTAMDVVYALKRQGRTLYGFGG
Ligand information
>8a3y Chain T (length=138) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcagaatcccggtgccgaggccgctcaattggtcgtagacagctctagc
accgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgcccagct
ccctgctggctccgagtgggttctgccgctctcaatgg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8a3y Structure of a backtracked hexasomal intermediate of nucleosome transcription.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		R45 I46 S47 G48
Binding residue
(residue number reindexed from 1)		R21 I22 S23 G24
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8a3y, PDBe:8a3y, PDBj:8a3y
PDBsum8a3y
PubMed35858621
UniProtP62799|H4_XENLA Histone H4

[Back to BioLiP]