Structure of PDB 7oi8 Chain f Binding Site BS02

Receptor Information
>7oi8 Chain f (length=116) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YKTKPTHGIGKYKHLIKAEVRAINLGTDYEYGVLNIHLTAYDMTLAESYA
QYVHNLCNSLSIKVEESYAMPTKTILTTHERVVQISGLSATFAEIFLEII
QSSLPEGVRLSVKEHT
Ligand information
>7oi8 Chain B (length=56) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agaguguagcuuaaaagcacccaacuuacacuuaggagauucaauugacg
cucuga
<<<<<...<<<....>>>.<<.<<.......>>.>>....<<<..>>>.>
>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7oi8 A distinct assembly pathway of the human 39S late pre-mitoribosome.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		Q108 H111 N115 S124
Binding residue
(residue number reindexed from 1)		Q51 H54 N58 S67
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7oi8, PDBe:7oi8, PDBj:7oi8
PDBsum7oi8
PubMed34315873
UniProtQ96GC5|RM48_HUMAN Large ribosomal subunit protein mL48 (Gene Name=MRPL48)

[Back to BioLiP]