Structure of PDB 6qld Chain f Binding Site BS02

Receptor Information
>6qld Chain f (length=79) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLKSFLESVIRDSVTYT
EHAKRKTVTSLDVVYALKRQGRTLYGFGG
Ligand information
>6qld Chain G (length=124) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tcgagaatcccggtgccgaggccgctcaattggtcgtagacagctctagc
accgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaaggg
gattactccctagtctccaggcac
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qld Structure of the inner kinetochore CCAN complex assembled onto a centromeric nucleosome.
Resolution4.15 Å
Binding residue
(original residue number in PDB)
R36 R46 I47 S48 G49 R79 K80 T81
Binding residue
(residue number reindexed from 1)
R12 R22 I23 S24 G25 R55 K56 T57
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity

View graph for
Molecular Function
External links
PDB RCSB:6qld, PDBe:6qld, PDBj:6qld
PDBsum6qld
PubMed31578520
UniProtP02309|H4_YEAST Histone H4 (Gene Name=HHF1)

[Back to BioLiP]