Structure of PDB 7osa Chain eL37 Binding Site BS02

Receptor Information

>7osa Chain eL37 (length=85) Species: 4932 (Saccharomyces cerevisiae)

GKGTPSFGKRHNKSHTLCNRCGRRSFHVQKKTCSSCGYPAAKTRSYNWGA
KAKRRHTTGTGRMRYLKHVSRRFKNGFQTGSASKA

Ligand information

>7osa Chain 58S (length=158)

aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaaaugcgauacguaaugugaauugcagaauuccgugaaucaucgaaucu
uugaacgcacauugcgccccuugguauuccagggggcaugccuguuugag
cgucauuu

.........................................<<<<<<.<<
.....>>>.....(.<<<......>>..............>>>..)...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
........

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7osa Accuracy mechanism of eukaryotic ribosome translocation.
• Resolution: 3.0 Å
• Binding residue (original residue number in PDB): R21 C22 G23 V29 K32 A42 T59 G60 T61 G62 R63 M64 R65 Y66 L67 K68 R72 F74 K75 N76 Q79 G81 S82 A83 K85
• Binding residue (residue number reindexed from 1): R20 C21 G22 V28 K31 A41 T58 G59 T60 G61 R62 M63 R64 Y65 L66 K67 R71 F73 K74 N75 Q78 G80 S81 A82 K84

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 22 17:34:27 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7osa', asym_id = 'eL37', bs = 'BS02', title = 'Accuracy mechanism of eukaryotic ribosome translocation.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7osa', asym_id='eL37', bs='BS02', title='Accuracy mechanism of eukaryotic ribosome translocation.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '7osa', asym_id = 'eL37'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='7osa', asym_id='eL37')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>