Structure of PDB 8pj5 Chain e Binding Site BS02

Receptor Information
>8pj5 Chain e (length=82) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KAKKKKWSKGKVRDKLNNLVLFDKATYDKLCKEVPNYKLITPAVVSERLK
IRGSLARAALQELLSKGLIKLVSKHRAQVIYT
Ligand information
>8pj5 Chain w (length=75) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agcagaguggcgcagcggaagcgugcugggcccauaacccagaggucgau
ggaucgaaaccauccucugcuacca
<<<<<<<..<<<<.......>>>>.<<<<<.......>>>>>.....<<<
<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pj5 Structural basis for translational control by the human 48S initiation complex from codon scanning toward subunit joining
Resolution2.9 Å
Binding residue
(original residue number in PDB)		K33 W35
Binding residue
(residue number reindexed from 1)		K5 W7
External links
PDB RCSB:8pj5, PDBe:8pj5, PDBj:8pj5
PDBsum8pj5
PubMed
UniProtP62851|RS25_HUMAN Small ribosomal subunit protein eS25 (Gene Name=RPS25)

[Back to BioLiP]