Structure of PDB 8byq Chain e Binding Site BS02

Receptor Information
>8byq Chain e (length=98) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS
SAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Ligand information
>8byq Chain T (length=198) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tcggatgtatatatctgacacgtgcctggagactagggagtaatcccctt
ggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgctag
agctgtctacgaccaattgagcggcctcggcaccgggattctcgatcgga
agagagtgaggacgaacgcgcccccacccccttttatagccccccttc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8byq Structural basis of transcription reduction by a promoter-proximal +1 nucleosome.
Resolution4.1 Å
Binding residue
(original residue number in PDB)		K38 R43 T46 R73 R84 F85 Q86 S87 R117 V118 T119
Binding residue
(residue number reindexed from 1)		K1 R6 T9 R36 R47 F48 Q49 S50 R80 V81 T82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8byq, PDBe:8byq, PDBj:8byq
PDBsum8byq
PubMed37148879
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]