Structure of PDB 6vyp Chain e Binding Site BS02

Receptor Information
>6vyp Chain e (length=103) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TMQTARKSTGYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRI
RGE
Ligand information
>6vyp Chain j (length=191) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcgtcgctgttcaatacatgcacaggatgtatatatctgacacgtgcct
ggagactagggagtaatccccttggcggttaaaacgcgggggacagcgcg
tacgtgcgtttaagcggtgctagagctgtctacgaccaattgagcggcct
cggcaccgggattctccagggcggccgcgtatagggtcgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6vyp Crystal Structure of the LSD1/CoREST Histone Demethylase Bound to Its Nucleosome Substrate.
Resolution4.99 Å
Binding residue
(original residue number in PDB)		Y41 R42 T45 R63 R72 R83 F84 Q85 R116 V117 T118 M120
Binding residue
(residue number reindexed from 1)		Y11 R12 T15 R33 R42 R53 F54 Q55 R86 V87 T88 M90
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6vyp, PDBe:6vyp, PDBj:6vyp
PDBsum6vyp
PubMed32396821
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]