Structure of PDB 5on6 Chain e Binding Site BS02

Receptor Information

>5on6 Chain e (length=53) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ENVWFSHPRRYGKGSRQCRVCSSHTGLIRKYGLNICRQCFREKANDIGFN
KFR

Ligand information

InChI=1S/6H2N.Os/h6*1H2;/q6*-1;+6

OWCQTVJQFLTQTE-UHFFFAOYSA-N

SMILES

Software	SMILES
ACDLabs 12.01 CACTVS 3.370 OpenEye OEToolkits 1.7.0	N[Os](N)(N)(N)(N)N

Formula

H12 N6 Os

Name

osmium (III) hexammine;
osmium(6+) hexaazanide

PDB chain

5on6 Chain e Residue 101 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5on6 The Amaryllidaceae Alkaloid Haemanthamine Binds the Eukaryotic Ribosome to Repress Cancer Cell Growth.
Resolution	3.1 Å
Binding residue (original residue number in PDB)	S25 H27
Binding residue (residue number reindexed from 1)	S22 H24
Annotation score	1

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008270	zinc ion binding
GO:0046872	metal ion binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5on6, PDBe:5on6, PDBj:5on6
PDBsum	5on6
PubMed	29429877
UniProt	P41057\|RS29A_YEAST Small ribosomal subunit protein uS14A (Gene Name=RPS29A)

[Back to BioLiP]