Structure of PDB 8t5h Chain d Binding Site BS02

Receptor Information

>8t5h Chain d (length=150) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAA
IQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIAGG
AMRAVLEVAGVHNVLAKAYGSTNPINVVRATIDGLENMNSPEMVAAKRGK

Ligand information

>8t5h Chain x (length=12) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

augagcacaaaa

............

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8t5h How Dedicated Ribosomes Translate a Leaderless mRNA.
Resolution	3.3 Å
Binding residue (original residue number in PDB)	V17 R19 R28 F30 F32
Binding residue (residue number reindexed from 1)	V9 R11 R20 F22 F24

External links

PDB	RCSB:8t5h, PDBe:8t5h, PDBj:8t5h
PDBsum	8t5h
PubMed	38185325

[Back to BioLiP]