Structure of PDB 8a3y Chain d Binding Site BS02

Receptor Information
>8a3y Chain d (length=95) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Ligand information
>8a3y Chain T (length=138) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcagaatcccggtgccgaggccgctcaattggtcgtagacagctctagc
accgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgcccagct
ccctgctggctccgagtgggttctgccgctctcaatgg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8a3y Structure of a backtracked hexasomal intermediate of nucleosome transcription.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		R30 Y39 G50 I51 S53 R83 S84 T85
Binding residue
(residue number reindexed from 1)		R3 Y12 G23 I24 S26 R56 S57 T58
External links