Structure of PDB 7pir Chain d Binding Site BS02

Receptor Information

>7pir Chain d (length=175) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NLKAHYQKTIAKELQKSFAFSSIMQVPRLEKIVINMGVGDAIRDSKFLES
ALNELHLISGQKPVATKAKNAISTYKLRAGQLIGCKVTLRGERMWAFLEK
LIYVALPRVRDFRGLSLKSFDGRGNYTIGIKEQIIFPEIVYDDIKRIRGF
DVTLVTSTNKDSEALALLRALNLPL

Ligand information

>7pir Chain 4 (length=105) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

uuuggugcccaugucgcuguggaaacaccugguuccauuucgaacccagc
aguuaagcacaguggagccgaauguagcugcagugagaauaggaaagcac
caagc

.<.<<<<......<<<<<<<<.....<<<<<...............>>>.
.>>....>>>>>>.>>.<<......................>>....>>>
>.>..

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7pir Visualizing translation dynamics at atomic detail inside a bacterial cell.
Resolution	12.1 Å
Binding residue (original residue number in PDB)	S23 S24 I25 M26 Q27 R30 Q63 V66 T90 R92 E94 R95
Binding residue (residue number reindexed from 1)	S21 S22 I23 M24 Q25 R28 Q61 V64 T88 R90 E92 R93

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7pir, PDBe:7pir, PDBj:7pir
PDBsum	7pir
PubMed	36171285
UniProt	Q50306\|RL5_MYCPN Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]