Structure of PDB 7pia Chain d Binding Site BS02

Receptor Information

>7pia Chain d (length=175) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NLKAHYQKTIAKELQKSFAFSSIMQVPRLEKIVINMGVGDAIRDSKFLES
ALNELHLISGQKPVATKAKNAISTYKLRAGQLIGCKVTLRGERMWAFLEK
LIYVALPRVRDFRGLSLKSFDGRGNYTIGIKEQIIFPEIVYDDIKRIRGF
DVTLVTSTNKDSEALALLRALNLPL

Ligand information

>7pia Chain 4 (length=105) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

uuuggugcccaugucgcuguggaaacaccugguuccauuucgaacccagc
aguuaagcacaguggagccgaauguagcugcagugagaauaggaaagcac
caagc

..<<.<.<.....<.<<<<<<.....<<<<<...............>>>.
.>>....>>>>>>..>.<<...<...<<....>>....>..>>...>.>.
>>...

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7pia Visualizing translation dynamics at atomic detail inside a bacterial cell.
Resolution	13.6 Å
Binding residue (original residue number in PDB)	K5 S23 S24 I25 M26 Q27 Q63 K64 V66 A67 T68 K88 T90 R92 R95
Binding residue (residue number reindexed from 1)	K3 S21 S22 I23 M24 Q25 Q61 K62 V64 A65 T66 K86 T88 R90 R93

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7pia, PDBe:7pia, PDBj:7pia
PDBsum	7pia
PubMed	36171285
UniProt	Q50306\|RL5_MYCPN Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]