Structure of PDB 7pai Chain d Binding Site BS02

Receptor Information
>7pai Chain d (length=175) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NLKAHYQKTIAKELQKSFAFSSIMQVPRLEKIVINMGVGDAIRDSKFLES
ALNELHLISGQKPVATKAKNAISTYKLRAGQLIGCKVTLRGERMWAFLEK
LIYVALPRVRDFRGLSLKSFDGRGNYTIGIKEQIIFPEIVYDDIKRIRGF
DVTLVTSTNKDSEALALLRALNLPL
Ligand information
>7pai Chain 4 (length=105) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuuggugcccaugucgcuguggaaacaccugguuccauuucgaacccagc
aguuaagcacaguggagccgaauguagcugcagugagaauaggaaagcac
caagc
<<<<<<<<.....<<<<<<<<.....<<<<<...............>>>.
.>>....>>>>>>.>>.<<..<....<<<..>>>.....>.>>...>>>>
>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7pai Visualizing translation dynamics at atomic detail inside a bacterial cell.
Resolution6.7 Å
Binding residue
(original residue number in PDB)		S24 Q27 R30 Q63 K64 V66 A67 T68 T90 R92
Binding residue
(residue number reindexed from 1)		S22 Q25 R28 Q61 K62 V64 A65 T66 T88 R90
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pai, PDBe:7pai, PDBj:7pai
PDBsum7pai
PubMed36171285
UniProtQ50306|RL5_MYCPN Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]