Structure of PDB 7on1 Chain d Binding Site BS02

Receptor Information
>7on1 Chain d (length=95) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKARKETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASK
LAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSS
Ligand information
>7on1 Chain D (length=21) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LRKSTRVKVAPLQYWRNEKIV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7on1 Cenp-A nucleosome in complex with Cenp-C
Resolution3.35 Å
Binding residue
(original residue number in PDB)		Q51 E109 L110 H113
Binding residue
(residue number reindexed from 1)		Q18 E76 L77 H80
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006301 postreplication repair
GO:0006325 chromatin organization
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0031298 replication fork protection complex
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7on1, PDBe:7on1, PDBj:7on1
PDBsum7on1
PubMed
UniProtP02293|H2B1_YEAST Histone H2B.1 (Gene Name=HTB1)

[Back to BioLiP]