Structure of PDB 6qld Chain d Binding Site BS02

Receptor Information
>6qld Chain d (length=93) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAA
YNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSST
Ligand information
>6qld Chain J (length=124) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gtgcctggagactagggagtaatccccttggcggttaaaacgcgggggac
agcgcgtacgtgcgtttaagcggtgctagagctgtctacgaccaattgag
cggcctcggcaccgggattctcga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qld Structure of the inner kinetochore CCAN complex assembled onto a centromeric nucleosome.
Resolution4.15 Å
Binding residue
(original residue number in PDB)		R37 K38 T40
Binding residue
(residue number reindexed from 1)		R1 K2 T4
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6qld, PDBe:6qld, PDBj:6qld
PDBsum6qld
PubMed31578520
UniProtP02294|H2B2_YEAST Histone H2B.2 (Gene Name=HTB2)

[Back to BioLiP]