Structure of PDB 6kac Chain d Binding Site BS02

Receptor Information
>6kac Chain d (length=348) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IGTYQEKRTWFDDADDWLRQDRFVFVGWSGLLLFPCAYFALGGWLTGTTF
VTSWYTHGLATSYLEGCNFLTAAVSTPANSMAHSLLFVWGPEAQGDFTRW
CQLGGLWAFVALHGAFGLIGFMLRQFEIARSVNLRPYNAIAFSAPIAVFV
SVFLIYPLGQSGWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGV
LGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQAEETYSMVTANRFWS
QIFGVAFSNKRWLHFFMLLVPVTGLWMSAIGVVGLALNLRAYDFVSQEIR
AAEDPEFETFYTKNILLNEGIRAWMAAQDQPHERLVFPEEVLPRGNAL
Ligand information
>6kac Chain 3 (length=25) Species: 3055 (Chlamydomonas reinhardtii) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AWAAAAGAAGAGYGVYRYEAAYGAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6kac Structural insight into light harvesting for photosystem II in green algae.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		E224 D225 G226 D227 A234 F235 N236 Q239 A240 E241
Binding residue
(residue number reindexed from 1)		E220 D221 G222 D223 A230 F231 N232 Q235 A236 E237
Enzymatic activity
Enzyme Commision number 1.10.3.9: photosystem II.
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0010242 oxygen evolving activity
GO:0016168 chlorophyll binding
GO:0016491 oxidoreductase activity
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0009772 photosynthetic electron transport in photosystem II
GO:0015979 photosynthesis
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0009507 chloroplast
GO:0009523 photosystem II
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6kac, PDBe:6kac, PDBj:6kac
PDBsum6kac
PubMed31768031
UniProtP06007|PSBD_CHLRE Photosystem II D2 protein (Gene Name=psbD)

[Back to BioLiP]