Structure of PDB 8s8j Chain c Binding Site BS02

Receptor Information
>8s8j Chain c (length=64) Species: 284590 (Kluyveromyces lactis NRRL Y-1140) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KTPVTLAKVIKVLGRTGSRGGVTQVRVEFLEDTTRTIVRNVKGPVREGDI
LVLMESEREARRLR
Ligand information
>8s8j Chain 3 (length=26) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cucuaacuauaaaaaucucucuucuc
..........................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8s8j Structural basis of AUC codon discrimination during translation initiation in yeast.
Resolution4.7 Å
Binding residue
(original residue number in PDB)		R64 R65 R67
Binding residue
(residue number reindexed from 1)		R61 R62 R64
External links
PDB RCSB:8s8j, PDBe:8s8j, PDBj:8s8j
PDBsum8s8j
PubMed39193907
UniProtP33285|RS28_KLULA Small ribosomal subunit protein eS28 (Gene Name=RPS28)

[Back to BioLiP]