Structure of PDB 8rw1 Chain c Binding Site BS02

Receptor Information
>8rw1 Chain c (length=64) Species: 284590 (Kluyveromyces lactis NRRL Y-1140) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KTPVTLAKVIKVLGRTGSRGGVTQVRVEFLEDTTRTIVRNVKGPVREGDI
LVLMESEREARRLR
Ligand information
>8rw1 Chain 3 (length=26) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cucuaacuauaaaaaucucucuucuc
..........................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rw1 Structural basis of AUC codon discrimination during translation initiation in yeast.
Resolution3.35 Å
Binding residue
(original residue number in PDB)		R64 R67
Binding residue
(residue number reindexed from 1)		R61 R64
External links
PDB RCSB:8rw1, PDBe:8rw1, PDBj:8rw1
PDBsum8rw1
PubMed39193907
UniProtP33285|RS28_KLULA Small ribosomal subunit protein eS28 (Gene Name=RPS28)

[Back to BioLiP]