Structure of PDB 8ovj Chain c Binding Site BS02

Receptor Information

>8ovj Chain c (length=229) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KRAAFKQQQTESFKKAVVARKAAKAALKKTAYLRARKYSREYRGAEKKLV
TLRRQAASHGNYYLEAKPKVAVVTRIRGIAKVNPKQRKILQLLRLRQIFN
TVFVKMNKPMENMLRAVEPYIAYGYPSLATVRAMVYKRGYLKINGQRVKI
TDNQMIKDKYNNVDIVCAEDMVNQIYTCGKHFRTVTHGMWPFKLAPPAGG
MRQKRRHFVEGGDYGNRDTLINRFLARMI

Ligand information

>8ovj Chain 8 (length=119) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gaguacgaccacacuugagugaaaacaccauaucccguccgauuugugaa
guuaagcacucacaggcucaguuaguacugaggucagugaugacucggga
acccugagugccguacucc

<<<<<<<......<<<<<<<<.....<<<<<..............>>>..
>>....>>>>>>.>><<<<<<......<<<<<..<<....>>.>>>>>..
...>>>>>>..>>>>>>>.

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8ovj Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
Resolution	2.4 Å
Binding residue (original residue number in PDB)	R138 E141 R228 H230 E233
Binding residue (residue number reindexed from 1)	R115 E118 R205 H207 E210

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ovj, PDBe:8ovj, PDBj:8ovj
PDBsum	8ovj
PubMed	38722744
UniProt	Q4Q9H4

[Back to BioLiP]