Structure of PDB 7zxe Chain c Binding Site BS02

Receptor Information
>7zxe Chain c (length=303) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EDPETCLQLNMVYQEVIQEKLAEANLLLAQNREQQEELMRDLAGSYMGHF
MKPYFKDKVTGVGPPANEDTREKAAQGIKAFEELLVTKWKNWEKALLRKS
VVSDRLQRLLQPKLLKLEYLHQKQSKVSSELERQALEKQGREAEKEIQDI
NQLPEEALLGNRLDSHDWEKISNINFEGSRSAEEIRKFWQNSEHPSINKQ
EWSREEEERLQAIAAAHGHLEWQKIAEELGTSRSAFQCLQKFQQHNKALK
RKEWTEEEDRMLTQLVQEMRVGSHIPYRRIVYYMEGRDSMQLIYRWTKSL
DPG
Ligand information
>7zxe Chain T (length=46) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ctctgccccgacacagcctcatacgcctcactctttacacacacgg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7zxe Structural basis of SNAPc-dependent snRNA transcription initiation by RNA polymerase II.
Resolution3.5 Å
Binding residue
(original residue number in PDB)
Y141 G143 H144 P371 Y372 R373 S384
Binding residue
(residue number reindexed from 1)
Y46 G48 H49 P276 Y277 R278 S289
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000995 RNA polymerase III general transcription initiation factor activity
GO:0001006 RNA polymerase III type 3 promoter sequence-specific DNA binding
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0016251 RNA polymerase II general transcription initiation factor activity
Biological Process
GO:0042795 snRNA transcription by RNA polymerase II
GO:0042796 snRNA transcription by RNA polymerase III
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0019185 snRNA-activating protein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7zxe, PDBe:7zxe, PDBj:7zxe
PDBsum7zxe
PubMed36424526
UniProtQ5SXM2|SNPC4_HUMAN snRNA-activating protein complex subunit 4 (Gene Name=SNAPC4)

[Back to BioLiP]