Structure of PDB 7syw Chain c Binding Site BS02

Receptor Information

>7syw Chain c (length=83) Species: 9986 (Oryctolagus cuniculus)

PLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQ
TVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH

Ligand information

>7syw Chain z (length=188)

cccccccucccgggagagccauaguggucugcggaaccggugaguacacc
ggaaugauuugggcgugcccccgcaagacugcuagccgaguaguguuggg
ucgcgaaaggccuugugguacugccugauagggugcuugcgagugccccg
ggaggucucguagaccgugcaccaugagcacgaauccu

.....<<<<<<<<<<<.<<<<<<<<<<<<<<<<<..<<<<<<....>>>>
>><<<.>>>.<<<....>>>>>>>>.>>>>>>>><<<.....<<......
..>>....>>>....>>>>.>><<<<....>>>><<...((((.>>>>>>
>>>>>.))))............................

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7syw Molecular architecture of 40S translation initiation complexes on the hepatitis C virus IRES.
• Resolution: 3.7 Å
• Binding residue (original residue number in PDB): D34 K36 Y41 I43 R80
• Binding residue (residue number reindexed from 1): D33 K35 Y40 I42 R79

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0046872 metal ion binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022626 cytosolic ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7syw, PDBe:7syw, PDBj:7syw
• PDBsum: 7syw
• PubMed: 35822879
• UniProt: G1TZ76|RS27_RABIT Small ribosomal subunit protein eS27 (Gene Name=RPS27)