Structure of PDB 7syp Chain c Binding Site BS02

Receptor Information
>7syp Chain c (length=83) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQ
TVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH
Ligand information
>7syp Chain z (length=249) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccugugaggaacuacugucuucacgcagaaagcgucuagccauggcguua
guaugagugucgugcagccuccaggacccccccucccgggagagccauag
uggucugcggaaccggugaguacaccggaaugauuugggcgugcccccgc
aagacugcuagccgaguaguguugggucgcgaaaggccuugugguacugc
cugauagggugcuugcgagugccccgggaggucucguagaccgugcacc
<<<<.<<<<.....<<<<...<<<.<<....<<<<<.......>>>>>..
...>>.>>>....>>>>>>>>>>>>......<<<<<<<<<<<.<<<<<<<
<<<<<<<<<<..<<<<<<....>>>>>><<<.>>>.<<<<..>>>>>>>>
>.>>>>>>>><<<.....<<<......>>>....>>>....>>>>.>><<
<<....>>>><<..(((((.>>>>>>>>>>>.)))))............
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7syp Molecular architecture of 40S translation initiation complexes on the hepatitis C virus IRES.
Resolution4.0 Å
Binding residue
(original residue number in PDB)		D34 K36 Y41 I43 R80
Binding residue
(residue number reindexed from 1)		D33 K35 Y40 I42 R79
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0046872 metal ion binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7syp, PDBe:7syp, PDBj:7syp
PDBsum7syp
PubMed35822879
UniProtG1TZ76|RS27_RABIT Small ribosomal subunit protein eS27 (Gene Name=RPS27)

[Back to BioLiP]