Structure of PDB 6gsn Chain c Binding Site BS02

Receptor Information
>6gsn Chain c (length=62) Species: 284590 (Kluyveromyces lactis NRRL Y-1140) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVTLAKVIKVLGRTGSRGGVTQVRVEFLEDTTRTIVRNVKGPVREGDILV
LMESEREARRLR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6gsn Large-scale movement of eIF3 domains during translation initiation modulate start codon selection.
Resolution5.75 Å
Binding residue
(original residue number in PDB)		R64 R67
Binding residue
(residue number reindexed from 1)		R59 R62
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
GO:0030490 maturation of SSU-rRNA
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6gsn, PDBe:6gsn, PDBj:6gsn
PDBsum6gsn
PubMed34648019
UniProtP33285|RS28_KLULA Small ribosomal subunit protein eS28 (Gene Name=RPS28)

[Back to BioLiP]