Structure of PDB 6giq Chain c Binding Site BS02

Receptor Information
>6giq Chain c (length=262) Species: 580240 (Saccharomyces cerevisiae W303) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RHQQHPFHMVMPSPWPIVVSFALLSLALSTALTMHGYIGNMNMVYLALFV
LLTSSILWFRDIVAEATYLGDHTMAVRKGINLGFLMFVLSEVLIFAGLFW
AYFHSAMSPDVTLGACWPPVGIEAVQPTELPLLNTIILLSSGATVTYSHH
ALIAGNRNKALSGLLITFWLIVIFVTCQYIEYTNAAFTISDGVYGSVFYA
GTGLHFLHMVMLAAMLGVNYWRMRNYHLTAGHHVGYETTIIYTHVLDVIW
LFLYVVFYWWGV
Ligand information
>6giq Chain k (length=18) Species: 580240 (Saccharomyces cerevisiae W303) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
WVALPAIALTAVNTYFVE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6giq Cryo-EM structure of the yeast respiratory supercomplex.
Resolution3.23 Å
Binding residue
(original residue number in PDB)
E136 L140 Y154
Binding residue
(residue number reindexed from 1)
E129 L133 Y147
Enzymatic activity
Enzyme Commision number 7.1.1.9: cytochrome-c oxidase.
Gene Ontology
Molecular Function
GO:0004129 cytochrome-c oxidase activity
GO:0009055 electron transfer activity
GO:0048039 ubiquinone binding
Biological Process
GO:0006123 mitochondrial electron transport, cytochrome c to oxygen
GO:0009060 aerobic respiration
GO:0019646 aerobic electron transport chain
GO:0022904 respiratory electron transport chain
GO:0045333 cellular respiration
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0016020 membrane
GO:0031966 mitochondrial membrane
GO:0045277 respiratory chain complex IV

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6giq, PDBe:6giq, PDBj:6giq
PDBsum6giq
PubMed30598556
UniProtP00420|COX3_YEAST Cytochrome c oxidase subunit 3 (Gene Name=COX3)

[Back to BioLiP]