Structure of PDB 6fyx Chain c Binding Site BS02

Receptor Information
>6fyx Chain c (length=64) Species: 284590 (Kluyveromyces lactis NRRL Y-1140) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KTPVTLAKVIKVLGRTGSRGGVTQVRVEFLEDTTRTIVRNVKGPVREGDI
LVLMESEREARRLR
Ligand information
>6fyx Chain 3 (length=31) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cucuaacuauaaaaaugucucuucucucucu
...............................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fyx Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		R64 R67
Binding residue
(residue number reindexed from 1)		R61 R64
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
GO:0030490 maturation of SSU-rRNA
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6fyx, PDBe:6fyx, PDBj:6fyx
PDBsum6fyx
PubMed30475211
UniProtP33285|RS28_KLULA Small ribosomal subunit protein eS28 (Gene Name=RPS28)

[Back to BioLiP]