Structure of PDB 5umd Chain c Binding Site BS02

Receptor Information
>5umd Chain c (length=89) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKAGKGTGSFGKRNGKTHFLCLRCGKRSYHLQKKKCASCGYPSAKKRRFN
WSVKAKRRNTTGTGRCRYIKTLRRKLKNKFTEGSTPKPK
Ligand information
>5umd Chain C (length=151) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agcacagucuuaacgauggaugucuugguuccuacagcgaugaaggccgc
agcaaaaugcgauacgcaaugaaaauugcagugacugaaucaucagaaug
cugaauguaaacuacaccaauucccugggaauagugguacuccuacagaa
a
............................................<<<<<<
.((.....>>>.....<.<<<<..<<.)).>>.......>>>>..>...>
>>....<<.....>><<<<<<<<<<.>>>>>>..>>>>............
.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5umd Mefloquine targets the Plasmodium falciparum 80S ribosome to inhibit protein synthesis.
Resolution3.2 Å
Binding residue
(original residue number in PDB)
K17 F20 L23 R24 C25 G26 Y30 L32 Y42 A45 T62 T64 G65 R66 C67 R68 Y69 I70 K71 L73 R75 K76 N79 F81 G84 S85 P87 K88 P89 K90
Binding residue
(residue number reindexed from 1)
K16 F19 L22 R23 C24 G25 Y29 L31 Y41 A44 T61 T63 G64 R65 C66 R67 Y68 I69 K70 L72 R74 K75 N78 F80 G83 S84 P86 K87 P88 K89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5umd, PDBe:5umd, PDBj:5umd
PDBsum5umd
PubMed28288098
UniProtC0H4L5

[Back to BioLiP]