Structure of PDB 5oy0 Chain c Binding Site BS02

Receptor Information

>5oy0 Chain c (length=81) Species: 1148 (Synechocystis sp. PCC 6803)

MSHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAAQIASSPRTEDCVG
CKRCETACPTDFLSIRVYLGAETTRSMGLAY

Ligand information

• Ligand ID: SF4
• InChI: InChI=1S/4Fe.4S
• InChIKey: LJBDFODJNLIPKO-UHFFFAOYSA-N
• SMILES:
  OpenEye OEToolkits 2.0.7: [S]12[Fe]3[S]4[Fe]1[S]5[Fe]2[S]3[Fe]45
  CACTVS 3.385: S1[Fe]S[Fe]1.S2[Fe]S[Fe]2
• Formula: Fe4 S4
• Name: IRON/SULFUR CLUSTER
• PDB chain: 5oy0 Chain c Residue 3003

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5oy0 Structure and function of wild-type and subunit-depleted photosystem I in Synechocystis.
• Resolution: 2.501 Å
• Binding residue (original residue number in PDB): C11 I12 G13 C14 T15 C17 A40 C58 P59 S64 I65
• Binding residue (residue number reindexed from 1): C11 I12 G13 C14 T15 C17 A40 C58 P59 S64 I65
• Annotation score: 1

Enzymatic activity

• Enzyme Commision number: 1.97.1.12: photosystem I.

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0009773 photosynthetic electron transport in photosystem I
• GO:0015979 photosynthesis

Cellular Component

• GO:0009522 photosystem I
• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0031676 plasma membrane-derived thylakoid membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:5oy0, PDBe:5oy0, PDBj:5oy0
• PDBsum: 5oy0
• PubMed: 29414678
• UniProt: P32422|PSAC_SYNY3 Photosystem I iron-sulfur center (Gene Name=psaC)