Structure of PDB 7a08 Chain b Binding Site BS02

Receptor Information
>7a08 Chain b (length=105) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEI
LELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQ
AVLLP
Ligand information
>7a08 Chain J (length=131) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ctgacacgtgcctggagactagggagtaatccccttggcggttaaaacgc
gggggacagcgcgtacgtgcgtttaagcggtgctagagcttgctacgacc
aattgagcggcctcggcaccgggattctcca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7a08 Structural basis for sequestration and autoinhibition of cGAS by chromatin.
Resolution3.11 Å
Binding residue
(original residue number in PDB)		R29 R42 V43 G44 A45 T76 R77
Binding residue
(residue number reindexed from 1)		R17 R30 V31 G32 A33 T64 R65
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0008285 negative regulation of cell population proliferation
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7a08, PDBe:7a08, PDBj:7a08
PDBsum7a08
PubMed32911480
UniProtQ93077|H2A1C_HUMAN Histone H2A type 1-C (Gene Name=H2AC6)

[Back to BioLiP]