Structure of PDB 6vyp Chain b Binding Site BS02

Receptor Information
>6vyp Chain b (length=80) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY
TEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Ligand information
>6vyp Chain j (length=191) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcgtcgctgttcaatacatgcacaggatgtatatatctgacacgtgcct
ggagactagggagtaatccccttggcggttaaaacgcgggggacagcgcg
tacgtgcgtttaagcggtgctagagctgtctacgaccaattgagcggcct
cggcaccgggattctccagggcggccgcgtatagggtcgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6vyp Crystal Structure of the LSD1/CoREST Histone Demethylase Bound to Its Nucleosome Substrate.
Resolution4.99 Å
Binding residue
(original residue number in PDB)
R45 I46 S47 G48 R78 K79 T80
Binding residue
(residue number reindexed from 1)
R23 I24 S25 G26 R56 K57 T58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6vyp, PDBe:6vyp, PDBj:6vyp
PDBsum6vyp
PubMed32396821
UniProtP62799|H4_XENLA Histone H4

[Back to BioLiP]