Structure of PDB 6cb1 Chain b Binding Site BS02

Receptor Information
>6cb1 Chain b (length=242) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QRTLLISSRGVNYRHRHLIQDLSGLLPHSRKEPKLDTKKDLQQLNEIAEL
YNCNNVLFFEARKHQDLYLWLSKPPNGPTIKFYIQNLHTMDEAAAAAAAA
AGSRPVLSFDQRFESSPHYQLIKELLVHNFGVPPAAAAAAAAADHVMSFS
IVDDKIWVRTYESLVEIGPRFVMTVILILEGSFGGPKIYENKQYVSPNVV
RAQIKQQAAEEAKSRAEAAVERKIKRRENVLAADPLSNDALF
Ligand information
>6cb1 Chain x (length=28) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAAAAAAAAAAAAAAAAAAAAAAAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6cb1 Modular assembly of the nucleolar pre-60S ribosomal subunit.
Resolution4.6 Å
Binding residue
(original residue number in PDB)
N82 P105
Binding residue
(residue number reindexed from 1)
N52 P75
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
GO:0042134 rRNA primary transcript binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0000464 endonucleolytic cleavage in ITS1 upstream of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000465 exonucleolytic trimming to generate mature 5'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0030687 preribosome, large subunit precursor

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6cb1, PDBe:6cb1, PDBj:6cb1
PDBsum6cb1
PubMed29512650
UniProtQ08235|BRX1_YEAST Ribosome biogenesis protein BRX1 (Gene Name=BRX1)

[Back to BioLiP]