Structure of PDB 6c0f Chain b Binding Site BS02

Receptor Information
>6c0f Chain b (length=242) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QRTLLISSRGVNYRHRHLIQDLSGLLPHSRKEPKLDTKKDLQQLNEIAEL
YNCNNVLFFEARKHQDLYLWLSKPPNGPTIKFYIQNLHTMDEAAAAAAAA
AGSRPVLSFDQRFESSPHYQLIKELLVHNFGVPPAAAAAAAAADHVMSFS
IVDDKIWVRTYESLVEIGPRFVMTVILILEGSFGGPKIYENKQYVSPNVV
RAQIKQQAAEEAKSRAEAAVERKIKRRENVLAADPLSNDALF
Ligand information
>6c0f Chain x (length=28) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAAAAAAAAAAAAAAAAAAAAAAAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6c0f Modular assembly of the nucleolar pre-60S ribosomal subunit.
Resolution3.7 Å
Binding residue
(original residue number in PDB)
R32 N82 N84 P105 E228 P234
Binding residue
(residue number reindexed from 1)
R2 N52 N54 P75 E180 P186
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
GO:0042134 rRNA primary transcript binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0000464 endonucleolytic cleavage in ITS1 upstream of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000465 exonucleolytic trimming to generate mature 5'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0030687 preribosome, large subunit precursor

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6c0f, PDBe:6c0f, PDBj:6c0f
PDBsum6c0f
PubMed29512650
UniProtQ08235|BRX1_YEAST Ribosome biogenesis protein BRX1 (Gene Name=BRX1)

[Back to BioLiP]