Structure of PDB 8s8f Chain a Binding Site BS02

Receptor Information
>8s8f Chain a (length=102) Species: 284590 (Kluyveromyces lactis NRRL Y-1140) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PKKRASNGRNKKGRGHVKPVRCVNCSRSVPKDKAIKRMAIRNIVEAAAIR
DLSEASVYAEYALPKTYNKLHYCISCAIHARIVRVRSRTDRRIRAPPQRP
RF
Ligand information
>8s8f Chain 3 (length=26) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cucuaacuauaaaaaucucucuucuc
..........................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8s8f Structural basis of AUC codon discrimination during translation initiation in yeast.
Resolution3.95 Å
Binding residue
(original residue number in PDB)		H80 R102
Binding residue
(residue number reindexed from 1)		H79 R101
External links