Structure of PDB 8ovj Chain a Binding Site BS02

Receptor Information

>8ovj Chain a (length=123) Species: 347515 (Leishmania major strain Friedlin)

HMKIKDLREKSKDDLLKTLTEYKKELSQLRVVQQTGGAETRLGRIRPIRK
SIARILTVLNQNERSNLKMFYADRKLRCKTPKVLRTKLTHRRRLALKENE
KNRKTSRQMRQAHKFPKRVYAVK

Ligand information

>8ovj Chain 7 (length=164)

aacgugucgcgauggaugacuuggcuuccuauuucguugaagaacgcagu
aaagugcgauaagugguaucaauugcagaacauucaauuaccgaaucuuu
gaacgcaaacggcgcaugggagaagcucgugucauccccgugcaugccau
auucucagugucga

.........................................<<<<<<.((
.....>>>.....<<<<<......))............>>>>.>...>>>
....<<.....>><<<<<<<....<<....>>....>>>>>>>.......
..............

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8ovj Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
• Resolution: 2.4 Å
• Binding residue (original residue number in PDB): R49 R52 K53 A56 R57 L59 T60 N63 Q64 R67 K85 K90 H93 R94
• Binding residue (residue number reindexed from 1): R46 R49 K50 A53 R54 L56 T57 N60 Q61 R64 K82 K87 H90 R91

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006412 translation

Cellular Component

• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8ovj, PDBe:8ovj, PDBj:8ovj
• PDBsum: 8ovj
• PubMed: 38722744
• UniProt: Q4Q8V7