Structure of PDB 7qiz Chain a Binding Site BS02

Receptor Information
>7qiz Chain a (length=132) Species: 4081 (Solanum lycopersicum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKYNPRVSSSRRKSRKAHFTAPSSVRRVLMSAPLSSELRAKYNVRSMPVR
KDDEVQVVRGTYKGREGKVVQVYRKKWVIHIERITREKVNGSTVNVGINP
SKVVVSKLRLDKDRRSLLDRKAKGRAAADKDK
Ligand information
>7qiz Chain 8 (length=159) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aacgacucucggcaacggauaucucggcucucgcaucgaugaagaacgua
gcgaaaugcgauacuuggugugaauugcagaaucccgugaaccaucgagu
cuuugaacgcaaguugcgcccgaagccauggccgagggcacgucugccug
ggcgucacg
...........................................<<<<<<.
((.....>>>.....<<<<<......))..............>>>>.>..
.>>>....<<.....>><<<<...<<<..>>>...>>>>...........
.........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qiz Specific features and methylation sites of a plant ribosome
Resolution2.38 Å
Binding residue
(original residue number in PDB)		R11 R12 R15 K16 F19 P22 S23 S24 R27 R50 K51 Q71 V72 Y73 R74 K75 L110 D111 K112 D113 R115
Binding residue
(residue number reindexed from 1)		R11 R12 R15 K16 F19 P22 S23 S24 R27 R50 K51 Q71 V72 Y73 R74 K75 L110 D111 K112 D113 R115
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qiz, PDBe:7qiz, PDBj:7qiz
PDBsum7qiz
PubMed35643637
UniProtA0A3Q7FBC6

[Back to BioLiP]