Structure of PDB 7nkx Chain a Binding Site BS02

Receptor Information
>7nkx Chain a (length=76) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTN
LCAIHAKRVTIMPKDIQLARRIRGER
Ligand information
>7nkx Chain N (length=128) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gtttttttctggagactagggagtaatccccttggcggttaaaacgcggg
ggacagcgcgtacgtgcgtttaagcggtgctagagctgtctacgaccaat
tgagcggcctcggcaccgggattctgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7nkx Structural basis of nucleosome transcription mediated by Chd1 and FACT.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		R63 L65 P66 R69
Binding residue
(residue number reindexed from 1)		R5 L7 P8 R11
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7nkx, PDBe:7nkx, PDBj:7nkx
PDBsum7nkx
PubMed33846633
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]