Structure of PDB 6wqq Chain a Binding Site BS02

Receptor Information
>6wqq Chain a (length=110) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KIDKNKVRLKRHARVRTNLSGTAEKPRLNVYRSNKHIYAQIIDDNKGVTL
AQASSKTATKVELATKVGEAIAKKAADKGIKEIVFDRGGYLYHGRVKALA
EAARESGLEF
Ligand information
>6wqq Chain 2 (length=111) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cuggugacuauagcaaggaggucacaccuguucccaugccgaacacagaa
guuaagcuccuuagcgacgaugguaguccaacuuacguuccgcuagagua
gaacguuccag
<.<<........<<<<<<<<.....<<<<<...............>>>..
>>....>>>>>>.>>.....<....<..............>.....>...
......>>..>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6wqq Characterization of the Core Ribosomal Binding Region for the Oxazolidone Family of Antibiotics Using Cryo-EM.
Resolution3.1 Å
Binding residue
(original residue number in PDB)
K4 D6 K7 R11 R19 N32 Y34 S36 N37 K38 H39 Q43 V51 T52 Q55 A67 T68 V70 H102 G103
Binding residue
(residue number reindexed from 1)
K1 D3 K4 R8 R16 N29 Y31 S33 N34 K35 H36 Q40 V48 T49 Q52 A58 T59 V61 H93 G94
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6wqq, PDBe:6wqq, PDBj:6wqq
PDBsum6wqq
PubMed32566908
UniProtQ2FW22|RL18_STAA8 Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]