Structure of PDB 6wqq Chain a Binding Site BS02

Receptor Information

>6wqq Chain a (length=110) Species: 1280 (Staphylococcus aureus)

KIDKNKVRLKRHARVRTNLSGTAEKPRLNVYRSNKHIYAQIIDDNKGVTL
AQASSKTATKVELATKVGEAIAKKAADKGIKEIVFDRGGYLYHGRVKALA
EAARESGLEF

Ligand information

>6wqq Chain 2 (length=111)

cuggugacuauagcaaggaggucacaccuguucccaugccgaacacagaa
guuaagcuccuuagcgacgaugguaguccaacuuacguuccgcuagagua
gaacguuccag

<.<<........<<<<<<<<.....<<<<<...............>>>..
>>....>>>>>>.>>.....<....<..............>.....>...
......>>..>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6wqq Characterization of the Core Ribosomal Binding Region for the Oxazolidone Family of Antibiotics Using Cryo-EM.
• Resolution: 3.1 Å
• Binding residue (original residue number in PDB): K4 D6 K7 R11 R19 N32 Y34 S36 N37 K38 H39 Q43 V51 T52 Q55 A67 T68 V70 H102 G103
• Binding residue (residue number reindexed from 1): K1 D3 K4 R8 R16 N29 Y31 S33 N34 K35 H36 Q40 V48 T49 Q52 A58 T59 V61 H93 G94

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6wqq, PDBe:6wqq, PDBj:6wqq
• PDBsum: 6wqq
• PubMed: 32566908
• UniProt: Q2FW22|RL18_STAA8 Large ribosomal subunit protein uL18 (Gene Name=rplR)