Structure of PDB 6gsn Chain a Binding Site BS02

Receptor Information
>6gsn Chain a (length=98) Species: 284590 (Kluyveromyces lactis NRRL Y-1140) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PKKRASNGRNKKGRGHVKPVRCVNCSRSVPKDKAIKRMAIRNIVEAAAIR
DLSEASVYAEYALPKTYNKLHYCISCAIHARIVRVRSRTDRRIRAPPQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6gsn Large-scale movement of eIF3 domains during translation initiation modulate start codon selection.
Resolution5.75 Å
Binding residue
(original residue number in PDB)		R42 A47 K66
Binding residue
(residue number reindexed from 1)		R41 A46 K65
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6gsn, PDBe:6gsn, PDBj:6gsn
PDBsum6gsn
PubMed34648019
UniProtQ6CS01

[Back to BioLiP]