Structure of PDB 3jcs Chain a Binding Site BS02

Receptor Information

>3jcs Chain a (length=124) Species: 5661 (Leishmania donovani)

HHMKIKDLREKSKDDLLKTLTEYKKELSQLRVVQQTGGAETRLGRIRPIR
KSIARILTVLNQNERSNLKMFYADRKLRCKTPKVLRAKLTHRRRLALKEN
EKNRKTSRQMRQAHKFPKRVYAVK

Ligand information

>3jcs Chain 7 (length=154)

aacgugucgcgauggaugacuuggcuuccuauucguugaagaacgcagua
aagugcgauaagugguaucaauugcagaaauuaccaaucuuugaacgcaa
acggcgcaugggagaagcuugucauccccgugcaugccauauucucagug
ucga

........................................<<<<<<<((.
...>>>>.....<<<<<......))......>>>>>...>>>....<<..
...>><<<<<<<.<(.<<..>>>.).>>>>>>>.................
....

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3jcs 2.8- angstrom Cryo-EM Structure of the Large Ribosomal Subunit from the Eukaryotic Parasite Leishmania.
• Resolution: 2.8 Å
• Binding residue (original residue number in PDB): I7 R11 Q36 R49 R52 K53 A56 R57 L59 T60 N63 R67 K85 R88 K90 T92 H93 R94 R96
• Binding residue (residue number reindexed from 1): I5 R9 Q34 R47 R50 K51 A54 R55 L57 T58 N61 R65 K83 R86 K88 T90 H91 R92 R94

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3jcs, PDBe:3jcs, PDBj:3jcs
• PDBsum: 3jcs
• PubMed: 27373148
• UniProt: E9BIP6