Structure of PDB 8s1p Chain Z Binding Site BS02

Receptor Information
>8s1p Chain Z (length=58) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKLEITLKRSVIGRPEDQRVTVRTLGLKKTNQTVVHEDNAAIRGMINKVS
HLVSVKEQ
Ligand information
>8s1p Chain B (length=112) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ugguggcgauagcgaagaggucacacccguucccauaccgaacacggaag
uuaagcucuucagcgccgaugguagucggggguuucccccugugagagua
ggacgccgccaa
<<<<<<<....<<<<<<<<.....<<<<<...............>>>..>
>....>>>>>>.>>.<<.......<<.<<<<<...>>>>>.>>.......
>>..>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8s1p A role for the S4-domain containing protein YlmH in ribosome-associated quality control in Bacillus subtilis.
Resolution1.96 Å
Binding residue
(original residue number in PDB)		R15 Q19 H52
Binding residue
(residue number reindexed from 1)		R14 Q18 H51
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8s1p, PDBe:8s1p, PDBj:8s1p
PDBsum8s1p
PubMed38811035
UniProtP19947|RL30_BACSU Large ribosomal subunit protein uL30 (Gene Name=rpmD)

[Back to BioLiP]