Structure of PDB 8e74 Chain Z Binding Site BS02

Receptor Information
>8e74 Chain Z (length=122) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DPAAALKAELRSKPGDWYVVHSYAGYENKVKANLETRVQNLDVGDYIFQV
EVPTEEVTEIKNGQRKQVNRKVLPGYILVRMDLTDDSWAAVRNTPGVTGF
VGATSRPSALALDDVVKFLLPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8e74 Structural and functional basis of the universal transcription factor NusG pro-pausing activity in Mycobacterium tuberculosis.
Resolution2.94 Å
Binding residue
(original residue number in PDB)		Y58 K61
Binding residue
(residue number reindexed from 1)		Y26 K29
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006353 DNA-templated transcription termination
GO:0006354 DNA-templated transcription elongation
GO:0031564 transcription antitermination
GO:0032784 regulation of DNA-templated transcription elongation
GO:0140673 transcription elongation-coupled chromatin remodeling
Cellular Component
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0009274 peptidoglycan-based cell wall

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8e74, PDBe:8e74, PDBj:8e74
PDBsum8e74
PubMed37116494
UniProtP9WIU9|NUSG_MYCTU Transcription termination/antitermination protein NusG (Gene Name=nusG)

[Back to BioLiP]