Structure of PDB 8aag Chain Z Binding Site BS02

Receptor Information
>8aag Chain Z (length=73) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HPKYSDMILAAVQAEKSRSGSSRQSIQKYIKNHYKVGENADSQIKLSIKR
LVTSGALKQTKGVGASGSFRLAK
Ligand information
>8aag Chain J (length=185) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
taatattggccagctaggatatcacaatcccggtgccgaggccgctcaat
tggtcgtagacagctctagcaccgcttaaacgcacgtacggattccgtac
gtgcgtttaagcggtgctagagctgtctacgaccaattgagcggcctcgg
caccgggattgtgatatcctagctggccaatatta
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8aag Nucleosome dyad determines the H1 C-terminus collapse on distinct DNA arms.
Resolution10.0 Å
Binding residue
(original residue number in PDB)		H25 K27 Q67 R74
Binding residue
(residue number reindexed from 1)		H1 K3 Q43 R50
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
Biological Process
GO:0006334 nucleosome assembly
GO:0030261 chromosome condensation
GO:0045910 negative regulation of DNA recombination
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8aag, PDBe:8aag, PDBj:8aag
PDBsum8aag
PubMed36610392
UniProtP22844|H10B_XENLA Histone H1.0-B (Gene Name=h1-0-b)

[Back to BioLiP]