Structure of PDB 6ogg Chain Z Binding Site BS02

Receptor Information
>6ogg Chain Z (length=65) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKASAV
KRHAKKLARENARRT
Ligand information
>6ogg Chain 4 (length=20) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aggagguaaaaaugugaaaa
....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ogg Extensive ribosome and RF2 rearrangements during translation termination.
Resolution4.2 Å
Binding residue
(original residue number in PDB)		R20 A25 G26 A29 E30 H55
Binding residue
(residue number reindexed from 1)		R18 A23 G24 A27 E28 H53
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ogg, PDBe:6ogg, PDBj:6ogg
PDBsum6ogg
PubMed31513010
UniProtP68679|RS21_ECOLI Small ribosomal subunit protein bS21 (Gene Name=rpsU)

[Back to BioLiP]