Structure of PDB 5uyp Chain Z Binding Site BS02

Receptor Information
>5uyp Chain Z (length=392) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGAARAFDQID
NAPEEKARGITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDG
AILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVE
MEVRELLSQYDFPGDDTPIVRGSALKALEGDAEWEAKILELAGFLDSYIP
EPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVGEEVEIVGIKET
QKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIKP
HTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMV
MPGDNIKMVVTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVL
Ligand information
>5uyp Chain Y (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggucguuagcucaguugguagagcaguugacuuuuaaucaauuggucgc
agguucgaauccugcacgacccacca
<<<<<<<..<<<<........>>>>.<<<<<.......>>>>>.....<<
<<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5uyp Ensemble cryo-EM elucidates the mechanism of translation fidelity
Resolution3.9 Å
Binding residue
(original residue number in PDB)		P53 D86 Y87 N90 F218 S219 V226 T228 G257 E259 R262 G275 R288 R318 H319 T320 F323 Y326 R327 Q329 T338 H364 G379
Binding residue
(residue number reindexed from 1)		P53 D86 Y87 N90 F218 S219 V226 T228 G257 E259 R262 G275 R288 R318 H319 T320 F323 Y326 R327 Q329 T338 H364 G379
Enzymatic activity
Catalytic site (original residue number in PDB) D21 K24 T25 T61 H84
Catalytic site (residue number reindexed from 1) D21 K24 T25 T61 H84
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003746 translation elongation factor activity
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0097216 guanosine tetraphosphate binding
Biological Process
GO:0006412 translation
GO:0006414 translational elongation
GO:0046677 response to antibiotic
Cellular Component
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0032045 guanyl-nucleotide exchange factor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5uyp, PDBe:5uyp, PDBj:5uyp
PDBsum5uyp
PubMed28538735
UniProtP0CE47|EFTU1_ECOLI Elongation factor Tu 1 (Gene Name=tufA)

[Back to BioLiP]