Structure of PDB 5t5h Chain Z Binding Site BS02

Receptor Information
>5t5h Chain Z (length=113) Species: 5693 (Trypanosoma cruzi) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSRRKARRAHFQAPSHVRRILMSAPLSKELRAKYNVRAMPVRKDDEVRVK
RGAYKGREGKVTACYRLRWVIHIDKVNREKANGTTVPVGVHPSNVEITKL
KLNHNRKAILERK
Ligand information
>5t5h Chain C (length=147) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aacgugucgcgauggaugacuuggcuuccuauuucguugaagaacgcagc
aaagugcgauaagugguaucaauugcagauuaccgaaucuuugaacgcaa
acggcgcaugggagaaauccccgugcaugccauauuucucagugucg
.........................................<<<<<<.((
.....>>>......<<<<......))....>>>>.....>>>....<<..
...>><<<<<<<.<...>.>>>>>>>.....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5t5h Structure and assembly model for the Trypanosoma cruzi 60S ribosomal subunit.
Resolution2.54 Å
Binding residue
(original residue number in PDB)		R9 R10 R13 R14 F17 Q18 P20 S21 H22 R48 K49 C70 Y71 R72 L73
Binding residue
(residue number reindexed from 1)		R3 R4 R7 R8 F11 Q12 P14 S15 H16 R42 K43 C64 Y65 R66 L67
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0015934 large ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5t5h, PDBe:5t5h, PDBj:5t5h
PDBsum5t5h
PubMed27791004
UniProtQ4DG45

[Back to BioLiP]